PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G059800.1
Common NamePHAVU_011G059800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 328aa    MW: 36685.8 Da    PI: 5.2191
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G059800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.86.1e-142067148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  Phvul.011G059800.1 20 KGLWSPEEDDKLMNYMLNSGQGCWSDVARNAGLQRCGKSCRLRWINYL 67
                        678*******************************************97 PP

2Myb_DNA-binding538.1e-1773116146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+el+v+++ +lG++ W+ Ia++++ gRt++++k++w++
  Phvul.011G059800.1  73 RGAFSPQEEELIVHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                         89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.141567IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-221770IPR009057Homeodomain-like
SuperFamilySSF466891.64E-2718114IPR009057Homeodomain-like
SMARTSM007172.4E-91969IPR001005SANT/Myb domain
PfamPF002491.2E-122067IPR001005SANT/Myb domain
CDDcd001673.53E-82367No hitNo description
PROSITE profilePS5129425.75468122IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-2671123IPR009057Homeodomain-like
SMARTSM007178.4E-1672120IPR001005SANT/Myb domain
PfamPF002492.6E-1573116IPR001005SANT/Myb domain
CDDcd001671.51E-1175115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MRKPEVSGKN NSNINYKLRK GLWSPEEDDK LMNYMLNSGQ GCWSDVARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EELIVHLHSL LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKNLSSNTS PNGSESSYDP NKDLNMAGFT TSNTHQDQLA DFMPMLNSSS PSPSMHATVL  180
NSIIDRLPLL DHGQNMPVSG GFFNGTEPYF SSQSGVDHKG FYLENGGVFG SVNIGAEGDM  240
YVPPLESVST TSDHNLKVES TCNTDTNNSY FDDINSVILN NCSNKRTENR AGVENLFQEE  300
LTMGEWDLEE LMKDVSSFPF LDFSNIQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271412221128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132019.10.0hypothetical protein PHAVU_011G059800g
TrEMBLV7AGN00.0V7AGN0_PHAVU; Uncharacterized protein
STRINGGLYMA12G06180.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-74myb domain protein 46